USP34 monoclonal antibody (M01), clone 2E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USP34 on formalin-fixed paraffin-embedded human seminoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP34 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP34 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP34.
Immunogen
USP34 (NP_055524, 3296 a.a. ~ 3395 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USP34 on formalin-fixed paraffin-embedded human seminoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP34 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP34 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USP34
-
Interactome
-
Disease
-
Publication Reference
-
The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.
Sy SM, Jiang J, O WS, Deng Y, Huen MS.
Nucleic Acids Research 2013 Oct; 41(18):8572.
Application：IF, WB, Human, HeLa cells.
-
Caveolin-1 (P132L), a Common Breast Cancer Mutation, Confers Mammary Cell Invasiveness and Defines a Novel Stem Cell/Metastasis-Associated Gene Signature.
Bonuccelli G, Casimiro MC, Sotgia F, Wang C, Liu M, Katiyar S, Zhou J, Dew E, Capozza F, Daumer KM, Minetti C, Milliman JN, Alpy F, Rio MC, Tomasetto C, Mercier I, Flomenberg N, Frank PG, Pestell RG, Lisanti MP.
The American Journal of Pathology 2009 May; 174(5):1650.
Application：WB, Mouse, Met-1 cells.
-
The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com