KNTC1 monoclonal antibody (M01), clone 10H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KNTC1 monoclonal antibody (M01), clone 10H4 Western Blot analysis of KNTC1 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KNTC1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to KNTC1 on HeLa cell. [antibody concentration 50 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KNTC1.
Immunogen
KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KNTC1 monoclonal antibody (M01), clone 10H4 Western Blot analysis of KNTC1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KNTC1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KNTC1 on HeLa cell. [antibody concentration 50 ug/ml] -
Gene Info — KNTC1
Entrez GeneID
9735GeneBank Accession#
NM_014708Protein Accession#
NP_055523Gene Name
KNTC1
Gene Alias
FLJ36151, KIAA0166, ROD
Gene Description
kinetochore associated 1
Omim ID
607363Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq
Other Designations
Rough Deal homolog, centromere/kinetochore protein
-
Interactome
-
Disease
-
Publication Reference
-
Modulations of cell cycle checkpoints during HCV associated disease.
Sarfraz S, Hamid S, Ali S, Jafri W, Siddiqui AA.
BMC Infectious Diseases 2009 Aug; 9:125.
Application：WB-Ti, Human, Human liver biopsy tissues.
-
Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
Chan YW, Fava LL, Uldschmid A, Schmitz MH, Gerlich DW, Nigg EA, Santamaria A.
The Journal of Cell Biology 2009 Jun; 185(5):859.
Application：WB-Ce, Human, HeLa S3 cells.
-
Modulations of cell cycle checkpoints during HCV associated disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com