Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SART3 (Human) Recombinant Protein (P01)

  • Catalog # : H00009733-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SART3 full-length ORF ( AAH41638.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009733-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9733
  • Gene Name:
  • SART3
  • Gene Alias:
  • DSAP1,KIAA0156,MGC138188,P100,RP11-13G14,TIP110,p110,p110(nrb)
  • Gene Description:
  • squamous cell carcinoma antigen recognized by T cells 3
  • Gene Summary:
  • The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing. [provided by RefSeq
  • Other Designations:
  • tat-interacting protein of 110 kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook