Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SART3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009733-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SART3 protein.
  • Immunogen:
  • SART3 (AAH41638.1, 1 a.a. ~ 129 a.a) full-length human protein.
  • Sequence:
  • MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SART3 MaxPab polyclonal antibody. Western Blot analysis of SART3 expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SART3 expression in transfected 293T cell line (H00009733-T01) by SART3 MaxPab polyclonal antibody.

    Lane 1: SART3 transfected lysate(14.19 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9733
  • Gene Name:
  • SART3
  • Gene Alias:
  • DSAP1,KIAA0156,MGC138188,P100,RP11-13G14,TIP110,p110,p110(nrb)
  • Gene Description:
  • squamous cell carcinoma antigen recognized by T cells 3
  • Gene Summary:
  • The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing. [provided by RefSeq
  • Other Designations:
  • tat-interacting protein of 110 kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook