NOS1AP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NOS1AP partial ORF ( NP_055512.1, 99 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.18
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NOS1AP
Entrez GeneID
9722GeneBank Accession#
NM_014697Protein Accession#
NP_055512.1Gene Name
NOS1AP
Gene Alias
6330408P19Rik, CAPON, MGC138500
Gene Description
nitric oxide synthase 1 (neuronal) adaptor protein
Gene Ontology
HyperlinkGene Summary
This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON)|OTTHUMP00000025714|ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com