Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HERPUD1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009709-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HERPUD1 partial ORF ( NP_055500, 74 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009709-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9709
  • Gene Name:
  • HERPUD1
  • Gene Alias:
  • HERP,KIAA0025,Mif1,SUP
  • Gene Description:
  • homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
  • Gene Summary:
  • The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq
  • Other Designations:
  • MMS-inducible,homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-like domain member 1 protein,methyl methanesulfonate (MMF)-inducible fragment protein 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook