HERPUD1 monoclonal antibody (M04), clone 2G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HERPUD1.
Immunogen
HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HERPUD1 monoclonal antibody (M04), clone 2G7 Western Blot analysis of HERPUD1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody (M04), clone 2G7.
Lane 1: HERPUD1 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of HERPUD1 transfected lysate using anti-HERPUD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HERPUD1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HERPUD1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HERPUD1
Entrez GeneID
9709GeneBank Accession#
NM_014685Protein Accession#
NP_055500Gene Name
HERPUD1
Gene Alias
HERP, KIAA0025, Mif1, SUP
Gene Description
homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Omim ID
608070Gene Ontology
HyperlinkGene Summary
The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq
Other Designations
MMS-inducible|homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-like domain member 1 protein|methyl methanesulfonate (MMF)-inducible fragment protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Radioprotective effects of genistein on HL-7702 cells via the inhibition of apoptosis and DNA damage.
Song L, Ma L, Cong F, Shen X, Jing P, Ying X, Zhou H, Jiang J, Yan H.
Cancer Letters 2015 Sep; 366(1):100.
Application:WB, Human, Embryo liver L-02 cells.
-
BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis.
Wang Y, Wan B, Li D, Zhou J, Li R, Bai M, Chen F, Yu L.
Biochemical and Biophysical Research Communications 2012 Jul; 423(4):813.
Application:IF, Human, HeLa cells.
-
Decreased ER-associated degradation of alpha-TCR induced by Grp78 depletion with the SubAB cytotoxin.
Lass A, Kujawa M, McConnell E, Paton AW, Paton JC, Wojcik C.
The International Journal of Biochemistry & Cell Biology 2008 Jun; 40(12):2865.
Application:WB-Ce, Human, COS-7, HeLa, HEK 293 cells.
-
Radioprotective effects of genistein on HL-7702 cells via the inhibition of apoptosis and DNA damage.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com