HERPUD1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HERPUD1.
Immunogen
HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Sequence
PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.88 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HERPUD1
Entrez GeneID
9709GeneBank Accession#
NM_014685Protein Accession#
NP_055500Gene Name
HERPUD1
Gene Alias
HERP, KIAA0025, Mif1, SUP
Gene Description
homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Omim ID
608070Gene Ontology
HyperlinkGene Summary
The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq
Other Designations
MMS-inducible|homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-like domain member 1 protein|methyl methanesulfonate (MMF)-inducible fragment protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Multi-level inhibition of coronavirus replication by chemical ER stress.
Mohammed Samer Shaban, Christin Müller, Christin Mayr-Buro, Hendrik Weiser, Johanna Meier-Soelch, Benadict Vincent Albert, Axel Weber, Uwe Linne, Torsten Hain, Ilya Babayev, Nadja Karl, Nina Hofmann, Stephan Becker, Susanne Herold, M Lienhard Schmitz, John Ziebuhr, Michael Kracht.
Nature Communications 2021 Sep; 12(1):5536.
Application:WB-Tr, Human, Monkey, Huh7, Vero cells.
-
Apoptosis induction of 2'-hydroxycinnamaldehyde as a proteasome inhibitor is associated with ER stress and mitochondrial perturbation in cancer cells.
Hong SH, Kim J, Kim JM, Lee SY, Shin DS, Son KH, Han DC, Sung YK, Kwon BM.
Biochemical Pharmacology 2007 May; 74(4):557.
Application:WB-Ce, Human, SW620 cells.
-
Multi-level inhibition of coronavirus replication by chemical ER stress.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com