RAPGEF2 monoclonal antibody (M01), clone 1E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAPGEF2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAPGEF2.
Immunogen
RAPGEF2 (XP_376350, 1398 a.a. ~ 1487 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (68)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAPGEF2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — RAPGEF2
Entrez GeneID
9693GeneBank Accession#
XM_376350Protein Accession#
XP_376350Gene Name
RAPGEF2
Gene Alias
CNrasGEF, NRAPGEP, PDZ-GEF1, PDZGEF1, RA-GEF, Rap-GEP
Gene Description
Rap guanine nucleotide exchange factor (GEF) 2
Omim ID
609530Gene Ontology
HyperlinkGene Summary
Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM
Other Designations
PDZ domain containing guanine nucleotide exchange factor (GEF) 1|RA(Ras/Rap1A-associating)-GEF|Rap guanine nucleotide exchange factor 2
-
Interactome
-
Pathway
-
Publication Reference
-
Rap2A links intestinal cell polarity to brush border formation.
Gloerich M, ten Klooster JP, Vliem MJ, Koorman T, Zwartkruis FJ, Clevers H, Bos JL.
Nature Cell Biology 2012 Aug; 14(8):793.
Application：WB-Ce, Human, Ls174T-W4 cells.
-
Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control.
Pannekoek WJ, van Dijk JJ, Chan OY, Huveneers S, Linnemann JR, Spanjaard E, Brouwer PM, van der Meer AJ, Zwartkruis FJ, Rehmann H, de Rooij J, Bos JL.
Cellular Signalling 2011 Dec; 23(12):2056.
Application：WB-Tr, Human, HUVECs.
-
PKC-theta selectively controls the adhesion-stimulating molecule Rap1.
Letschka T, Kollmann V, Pfeifhofer-Obermair C, Lutz-Nicoladoni C, Obermair GJ, Fresser F, Leitges M, Hermann-Kleiter N, Kaminski S, Baier G.
Blood 2008 Dec; 112(12):4617.
Application：WB, IP, Human, mouse, T cells.
-
Rap2A links intestinal cell polarity to brush border formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com