EIF5B monoclonal antibody (M02), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF5B is 0.1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF5B.
Immunogen
EIF5B (NP_056988, 1121 a.a. ~ 1218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF5B is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EIF5B
Entrez GeneID
9669GeneBank Accession#
NM_015904Protein Accession#
NP_056988Gene Name
EIF5B
Gene Alias
DKFZp434I036, FLJ10524, IF2, KIAA0741
Gene Description
eukaryotic translation initiation factor 5B
Omim ID
606086Gene Ontology
HyperlinkGene Summary
Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq
Other Designations
translation initiation factor IF2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com