EIF5B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (36.89 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EIF5B.
Immunogen
EIF5B (NP_056988, 1121 a.a. ~ 1218 a.a) partial recombinant protein with GST tag.
Sequence
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (89)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — EIF5B
Entrez GeneID
9669GeneBank Accession#
NM_015904Protein Accession#
NP_056988Gene Name
EIF5B
Gene Alias
DKFZp434I036, FLJ10524, IF2, KIAA0741
Gene Description
eukaryotic translation initiation factor 5B
Omim ID
606086Gene Ontology
HyperlinkGene Summary
Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq
Other Designations
translation initiation factor IF2
-
Interactome
-
Publication Reference
-
Cleavage of eukaryotic initiation factor eIF5B by enterovirus 3C proteases.
de Breyne S, Bonderoff JM, Chumakov KM, Lloyd RE, Hellen CU.
Virology 2008 Jun; 378(1):118.
Application：WB, Human, HEK 293T cells.
-
Cleavage of eukaryotic initiation factor eIF5B by enterovirus 3C proteases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com