Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ISG15 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00009636-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ISG15 protein.
  • Immunogen:
  • ISG15 (ENSP00000368699, 1 a.a. ~ 165 a.a) full-length human protein.
  • Sequence:
  • MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ISG15 expression in transfected 293T cell line (H00009636-T01) by ISG15 MaxPab polyclonal antibody.

    Lane 1: ISG15 transfected lysate(17.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9636
  • Gene Name:
  • ISG15
  • Gene Alias:
  • G1P2,IFI15,UCRP
  • Gene Description:
  • ISG15 ubiquitin-like modifier
  • Gene Summary:
  • ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA; MIM 147660) and -beta (IFNB; MIM 147640) (Zhao et al., 2005 [PubMed 16009940]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000038464,interferon, alpha-inducible protein (clone IFI-15K),interferon-induced 17-kDa/15-kDa protein,interferon-stimulated protein, 15 kDa,ubiquitin cross-reactive protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook