ISG15 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in mouse kidney.
Western Blot (Tissue lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in human spleen.
Western Blot (Cell lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of ISG15 expression in transfected 293T cell line (H00009636-T01) by ISG15 MaxPab polyclonal antibody.
Lane 1: ISG15 transfected lysate(17.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ISG15 transfected lysate using anti-ISG15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with G1P2 purified MaxPab mouse polyclonal antibody (B01P) (H00009636-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ISG15 protein.
Immunogen
ISG15 (ENSP00000368699, 1 a.a. ~ 165 a.a) full-length human protein.
Sequence
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (65); Rat (63)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in mouse kidney.Western Blot (Tissue lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in human spleen.Western Blot (Cell lysate)
ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of ISG15 expression in transfected 293T cell line (H00009636-T01) by ISG15 MaxPab polyclonal antibody.
Lane 1: ISG15 transfected lysate(17.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ISG15 transfected lysate using anti-ISG15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with G1P2 purified MaxPab mouse polyclonal antibody (B01P) (H00009636-B01P). -
Gene Info — ISG15
Entrez GeneID
9636GeneBank Accession#
NM_005101.1Protein Accession#
ENSP00000368699Gene Name
ISG15
Gene Alias
G1P2, IFI15, UCRP
Gene Description
ISG15 ubiquitin-like modifier
Omim ID
147571Gene Ontology
HyperlinkGene Summary
ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA; MIM 147660) and -beta (IFNB; MIM 147640) (Zhao et al., 2005 [PubMed 16009940]).[supplied by OMIM
Other Designations
OTTHUMP00000038464|interferon, alpha-inducible protein (clone IFI-15K)|interferon-induced 17-kDa/15-kDa protein|interferon-stimulated protein, 15 kDa|ubiquitin cross-reactive protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com