Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLCA2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009635-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLCA2 partial ORF ( NP_006527, 300 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009635-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9635
  • Gene Name:
  • CLCA2
  • Gene Alias:
  • CACC,CACC3,CLCRG2,CaCC-3,FLJ97885
  • Gene Description:
  • chloride channel regulator 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. Since this protein is expressed predominantly in trachea and lung, it is suggested to play a role in the complex pathogenesis of cystic fibrosis. It may also serve as adhesion molecule for lung metastatic cancer cells, mediating vascular arrest and colonization, and furthermore, it has been implicated to act as a tumor suppressor gene for breast cancer. [provided by RefSeq
  • Other Designations:
  • CLCA family member 2, chloride channel regulator,OTTHUMP00000011911,calcium-activated chloride channel protein 3,calcium-activated chloride channel-2,chloride channel, calcium activated, family member 2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook