GNA14 monoclonal antibody (M06), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06), clone 2H8.
Lane 1: GNA14 transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GNA14 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GNA14.
Immunogen
GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Specificity
This antibody cross-reacts with human GNA11.
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06), clone 2H8.
Lane 1: GNA14 transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GNA14 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — GNA14
Entrez GeneID
9630GeneBank Accession#
BC027886Protein Accession#
AAH27886.1Gene Name
GNA14
Gene Alias
-
Gene Description
guanine nucleotide binding protein (G protein), alpha 14
Omim ID
604397Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors
Other Designations
OTTHUMP00000021515|guanine nucleotide-binding protein 14
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com