Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RGS6 polyclonal antibody (A01)

  • Catalog # : H00009628-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RGS6.
  • Immunogen:
  • RGS6 (NP_004287, 207 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009628-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9628
  • Gene Name:
  • RGS6
  • Gene Alias:
  • DKFZp313G1241,FLJ43552,GAP,MGC142132
  • Gene Description:
  • regulator of G-protein signaling 6
  • Gene Summary:
  • Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits (Seki et al., 1999 [PubMed 10083744]).[supplied by OMIM
  • Other Designations:
  • G protein signaling 6 regulator,GTPase activating protein,H_DJ0283M22.1,H_DJ1108A12.1,WUGSC:H_DJ0283M22.1,WUGSC:H_DJ1108A12.1,regulator of G protein signaling 6,regulator of G protein signalling 6,regulator of G-protein signalling 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook