TRAF4 monoclonal antibody (M01), clone 3F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TRAF4 expression in transfected 293T cell line by TRAF4 monoclonal antibody (M01), clone 3F6.
Lane 1: TRAF4 transfected lysate(53.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRAF4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRAF4 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRAF4.
Immunogen
TRAF4 (AAH01769, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRAF4 expression in transfected 293T cell line by TRAF4 monoclonal antibody (M01), clone 3F6.
Lane 1: TRAF4 transfected lysate(53.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRAF4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRAF4 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — TRAF4
Entrez GeneID
9618GeneBank Accession#
BC001769Protein Accession#
AAH01769Gene Name
TRAF4
Gene Alias
CART1, MLN62, RNF83
Gene Description
TNF receptor-associated factor 4
Omim ID
602464Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq
Other Designations
cysteine-rich domain associated with ring and TRAF domain|malignant 62|tumor necrosis receptor-associated factor 4A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com