Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MTRF1 (Human) Recombinant Protein (P01)

  • Catalog # : H00009617-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MTRF1 full-length ORF ( ENSP00000239852, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009617-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9617
  • Gene Name:
  • MTRF1
  • Gene Alias:
  • MGC47721,MRF1,MTTRF1,RF1
  • Gene Description:
  • mitochondrial translational release factor 1
  • Gene Summary:
  • The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018315,OTTHUMP00000018316,mitochontrial peptide chain release factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook