RNF14 monoclonal antibody (M01), clone 4G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF14.
Immunogen
RNF14 (NP_004281, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF14 expression in transfected 293T cell line by RNF14 monoclonal antibody (M01), clone 4G9.
Lane 1: RNF14 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF14 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF14 over-expressed 293 cell line, cotransfected with RNF14 Validated Chimera RNAi ( Cat # H00009604-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF14 monoclonal antibody (M01), clone 4G9 (Cat # H00009604-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RNF14 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RNF14
Entrez GeneID
9604GeneBank Accession#
NM_004290Protein Accession#
NP_004281Gene Name
RNF14
Gene Alias
ARA54, FLJ26004, HFB30, HRIHFB2038, TRIAD2
Gene Description
ring finger protein 14
Omim ID
605675Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq
Other Designations
androgen receptor associated protein 54|triad2 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com