Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WTAP (Human) Recombinant Protein (Q01)

  • Catalog # : H00009589-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human WTAP partial ORF ( NP_690596.1, 70 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009589-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9589
  • Gene Name:
  • WTAP
  • Gene Alias:
  • DKFZp686F20131,KIAA0105,MGC3925
  • Gene Description:
  • Wilms tumor 1 associated protein
  • Gene Summary:
  • The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017522,OTTHUMP00000017523,PNAS-132,WT1-associated protein,Wilms' tumour 1-associating protein,putative pre-mRNA splicing regulator female-lethal(2D)
  • RSS
  • YouTube
  • Linkedin
  • Facebook