WTAP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WTAP partial ORF ( NP_690596.1, 70 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.76
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WTAP
Entrez GeneID
9589GeneBank Accession#
NM_152857Protein Accession#
NP_690596.1Gene Name
WTAP
Gene Alias
DKFZp686F20131, KIAA0105, MGC3925
Gene Description
Wilms tumor 1 associated protein
Omim ID
605442Gene Ontology
HyperlinkGene Summary
The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. [provided by RefSeq
Other Designations
OTTHUMP00000017522|OTTHUMP00000017523|PNAS-132|WT1-associated protein|Wilms' tumour 1-associating protein|putative pre-mRNA splicing regulator female-lethal(2D)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com