RNPC2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.24
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RBM39
Entrez GeneID
9584GeneBank Accession#
NM_184234Protein Accession#
NP_909122Gene Name
RBM39
Gene Alias
CAPER, CAPERalpha, CC1.3, DKFZp781C0423, FLJ44170, HCC1, RNPC2, fSAP59
Gene Description
RNA binding motif protein 39
Omim ID
604739Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030794|OTTHUMP00000030795|RNA-binding region (RNP1, RRM) containing 2|coactivator of activating protein-1 and estrogen receptors|functional spliceosome-associated protein 59|hepatocellular carcinoma protein 1|splicing factor CC1.3|splicing fac
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com