Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNPC2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009584-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RNPC2 partial ORF ( NP_909122, 423 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009584-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9584
  • Gene Name:
  • RBM39
  • Gene Alias:
  • CAPER,CAPERalpha,CC1.3,DKFZp781C0423,FLJ44170,HCC1,RNPC2,fSAP59
  • Gene Description:
  • RNA binding motif protein 39
  • Gene Summary:
  • The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030794,OTTHUMP00000030795,RNA-binding region (RNP1, RRM) containing 2,coactivator of activating protein-1 and estrogen receptors,functional spliceosome-associated protein 59,hepatocellular carcinoma protein 1,splicing factor CC1.3,splicing fac
  • RSS
  • YouTube
  • Linkedin
  • Facebook