RNPC2 monoclonal antibody (M01), clone 4G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNPC2.
Immunogen
RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNPC2 monoclonal antibody (M01), clone 4G8 Western Blot analysis of RNPC2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
RNPC2 monoclonal antibody (M01), clone 4G8. Western Blot analysis of RNPC2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody (M01), clone 4G8.
Lane 1: RBM39 transfected lysate(58.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — RBM39
Entrez GeneID
9584GeneBank Accession#
NM_184234Protein Accession#
NP_909122Gene Name
RBM39
Gene Alias
CAPER, CAPERalpha, CC1.3, DKFZp781C0423, FLJ44170, HCC1, RNPC2, fSAP59
Gene Description
RNA binding motif protein 39
Omim ID
604739Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030794|OTTHUMP00000030795|RNA-binding region (RNP1, RRM) containing 2|coactivator of activating protein-1 and estrogen receptors|functional spliceosome-associated protein 59|hepatocellular carcinoma protein 1|splicing factor CC1.3|splicing fac
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com