Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNPC2 polyclonal antibody (A01)

  • Catalog # : H00009584-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RNPC2.
  • Immunogen:
  • RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009584-A01
    Western Blot detection against Immunogen (31.61 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9584
  • Gene Name:
  • RBM39
  • Gene Alias:
  • CAPER,CAPERalpha,CC1.3,DKFZp781C0423,FLJ44170,HCC1,RNPC2,fSAP59
  • Gene Description:
  • RNA binding motif protein 39
  • Gene Summary:
  • The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030794,OTTHUMP00000030795,RNA-binding region (RNP1, RRM) containing 2,coactivator of activating protein-1 and estrogen receptors,functional spliceosome-associated protein 59,hepatocellular carcinoma protein 1,splicing factor CC1.3,splicing fac
  • RSS
  • YouTube
  • Linkedin
  • Facebook