PREPL purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PREPL expression in transfected 293T cell line (H00009581-T02) by PREPL MaxPab polyclonal antibody.
Lane 1: PREPL transfected lysate(79.97 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PREPL protein.
Immunogen
PREPL (NP_006027, 1 a.a. ~ 727 a.a) full-length human protein.
Sequence
MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PREPL expression in transfected 293T cell line (H00009581-T02) by PREPL MaxPab polyclonal antibody.
Lane 1: PREPL transfected lysate(79.97 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PREPL
Entrez GeneID
9581GeneBank Accession#
NM_006036Protein Accession#
NP_006027Gene Name
PREPL
Gene Alias
FLJ16627, KIAA0436
Gene Description
prolyl endopeptidase-like
Omim ID
609557Gene Ontology
HyperlinkGene Summary
PREPL belongs to the prolyl oligopeptidase subfamily of serine peptidases (Parvari et al., 2005 [PubMed 15913950]).[supplied by OMIM
Other Designations
putative prolyl oligopeptidase
-
Interactome
-
Publication Reference
-
Prolyl endopeptidase-like is a (thio)esterase involved in mitochondrial respiratory chain functio.
Karen Rosier, Molly T McDevitt, Joél Smet, Brendan J Floyd, Maxime Verschoore, Maria J Marcaida, Craig A Bingman, Irma Lemmens, Matteo Dal Peraro, Jan Tavernier, Benjamin F Cravatt, Natalia V Gounko, Katlijn Vints, Yenthe Monnens, Kritika Bhalla, Laetitia Aerts, Edrees H Rashan, Arnaud V Vanlander, Rudy Van Coster, Luc Régal, David J Pagliarini, John W M Creemers.
iScience 2021 Nov; 24(12):103460.
Application：WB, WB-Ce, Human, Mouse, Mousee brain, HEK293T cells.
-
Prolyl endopeptidase-like is a (thio)esterase involved in mitochondrial respiratory chain functio.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com