Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX13 polyclonal antibody (A01)

  • Catalog # : H00009580-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SOX13.
  • Immunogen:
  • SOX13 (NP_005677, 25 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009580-A01
    Western Blot detection against Immunogen (38.65 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9580
  • Gene Name:
  • SOX13
  • Gene Alias:
  • ICA12,MGC117216,Sox-13
  • Gene Description:
  • SRY (sex determining region Y)-box 13
  • Gene Summary:
  • This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. [provided by RefSeq
  • Other Designations:
  • SRY-box 13,SRY-related HMG-box gene 13,islet cell antibody 12,type 1 diabetes autoantigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook