CDC42BPB monoclonal antibody (M02), clone 6G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDC42BPB monoclonal antibody (M02), clone 6G3 Western Blot analysis of CDC42BPB expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDC42BPB on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC42BPB is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.
Immunogen
CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC42BPB monoclonal antibody (M02), clone 6G3 Western Blot analysis of CDC42BPB expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDC42BPB on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC42BPB is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — CDC42BPB
Entrez GeneID
9578GeneBank Accession#
AF128625Protein Accession#
AAD37506Gene Name
CDC42BPB
Gene Alias
KIAA1124, MRCKB
Gene Description
CDC42 binding protein kinase beta (DMPK-like)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq
Other Designations
CDC42-binding protein kinase beta|CDC42-binding protein kinase beta (DMPK-like)|myotonic dystrophy protein kinase-like beta
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com