GOSR2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GOSR2 MaxPab polyclonal antibody. Western Blot analysis of GOSR2 expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of GOSR2 expression in transfected 293T cell line (H00009570-T01) by GOSR2 MaxPab polyclonal antibody.
Lane 1: GOSR2 transfected lysate(23.43 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GOSR2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GOSR2 protein.
Immunogen
GOSR2 (NP_473363.1, 1 a.a. ~ 213 a.a) full-length human protein.
Sequence
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GOSR2 MaxPab polyclonal antibody. Western Blot analysis of GOSR2 expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of GOSR2 expression in transfected 293T cell line (H00009570-T01) by GOSR2 MaxPab polyclonal antibody.
Lane 1: GOSR2 transfected lysate(23.43 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GOSR2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GOSR2
Entrez GeneID
9570GeneBank Accession#
NM_054022.2Protein Accession#
NP_473363.1Gene Name
GOSR2
Gene Alias
Bos1, GS27
Gene Description
golgi SNAP receptor complex member 2
Omim ID
604027Gene Ontology
HyperlinkGene Summary
This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
membrin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Robust imaging and gene delivery to study human lymphoblastoid cell lines.
Jolly LA, Sun Y, Carroll R, Homan CC, Gecz J.
Journal of Human Genetics 2018 Jun; [Epub].
Application：IF, Human, Human lymphoblastoid cell lines.
-
Robust imaging and gene delivery to study human lymphoblastoid cell lines.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com