Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GTPBP1 polyclonal antibody (A01)

  • Catalog # : H00009567-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GTPBP1.
  • Immunogen:
  • GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GTPBP1 polyclonal antibody (A01), Lot # 060117JC01 Western Blot analysis of GTPBP1 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9567
  • Gene Name:
  • GTPBP1
  • Gene Alias:
  • GP-1,GP1,HSPC018,MGC20069
  • Gene Description:
  • GTP binding protein 1
  • Gene Summary:
  • This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq
  • Other Designations:
  • G-protein 1,OTTHUMP00000028811
  • RSS
  • YouTube
  • Linkedin
  • Facebook