Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

H6PD polyclonal antibody (A01)

  • Catalog # : H00009563-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant H6PD.
  • Immunogen:
  • H6PD (NP_004276, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009563-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9563
  • Gene Name:
  • H6PD
  • Gene Alias:
  • DKFZp686A01246,G6PDH,GDH,MGC87643
  • Gene Description:
  • hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
  • Gene Summary:
  • There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. [provided by RefSeq
  • Other Designations:
  • 6-phosphogluconolactonase,G6PD, H form,GDH/6PGL endoplasmic bifunctional protein,OTTHUMP00000001703,glucose 1- dehydrogenase,glucose dehydrogenase,glucose dehyrogenase,glucose-6-phosphate dehydrogenase, salivary,hexose-6-phosphate dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook