SEC22L1 monoclonal antibody (M01), clone 1E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SEC22L1 monoclonal antibody (M01), clone 1E1 Western Blot analysis of SEC22L1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
SEC22L1 monoclonal antibody (M01), clone 1E1. Western Blot analysis of SEC22L1 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEC22L1 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEC22L1.
Immunogen
SEC22L1 (NP_004883, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SEC22L1 monoclonal antibody (M01), clone 1E1 Western Blot analysis of SEC22L1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
SEC22L1 monoclonal antibody (M01), clone 1E1. Western Blot analysis of SEC22L1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEC22L1 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SEC22B
Entrez GeneID
9554GeneBank Accession#
NM_004892Protein Accession#
NP_004883Gene Name
SEC22B
Gene Alias
ERS-24, SEC22L1
Gene Description
SEC22 vesicle trafficking protein homolog B (S. cerevisiae)
Omim ID
604029Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins
Other Designations
SEC22 vesicle trafficking protein homolog B|SEC22 vesicle trafficking protein-like 1|SEC22, vesicle trafficking protein-like 1
-
Interactome
-
Pathway
-
Publication Reference
-
A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels.
Flowerdew SE, Burgoyne RD.
Biochemical Journal 2009 Mar; 418(3):529.
Application：ICC, Human, HeLa cells.
-
Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.
Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC.
Molecular & Cellular Proteomics 2008 Mar; 7(6):1174.
Application：WB, Human, HCT-116.
-
A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com