Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL14 (Human) Recombinant Protein (P01)

  • Catalog # : H00009547-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.95
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009547-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9547
  • Gene Name:
  • CXCL14
  • Gene Alias:
  • BMAC,BRAK,KS1,Kec,MGC10687,MIP-2g,NJAC,SCYB14,bolekine
  • Gene Description:
  • chemokine (C-X-C motif) ligand 14
  • Gene Summary:
  • This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq
  • Other Designations:
  • CXC chemokine in breast and kidney,small inducible cytokine B14,small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK)
  • RSS
  • YouTube
  • Linkedin
  • Facebook