TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TP53I3 expression in transfected 293T cell line (H00009540-T01) by TP53I3 MaxPab polyclonal antibody.
Lane 1: TP53I3 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TP53I3 protein.
Immunogen
TP53I3 (NP_004872.2, 1 a.a. ~ 332 a.a) full-length human protein.
Sequence
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TP53I3 expression in transfected 293T cell line (H00009540-T01) by TP53I3 MaxPab polyclonal antibody.
Lane 1: TP53I3 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TP53I3
Entrez GeneID
9540GeneBank Accession#
NM_004881Protein Accession#
NP_004872.2Gene Name
TP53I3
Gene Alias
PIG3
Gene Description
tumor protein p53 inducible protein 3
Omim ID
605171Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. At least two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000116037|p53-induced gene 3 protein|quinone oxidoreductase homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com