Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTGES (Human) Recombinant Protein (P01)

  • Catalog # : H00009536-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTGES full-length ORF ( AAH08280.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.46
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009536-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9536
  • Gene Name:
  • PTGES
  • Gene Alias:
  • MGC10317,MGST-IV,MGST1-L1,MGST1L1,MPGES,PGES,PIG12,PP102,PP1294,TP53I12,mPGES-1
  • Gene Description:
  • prostaglandin E synthase
  • Gene Summary:
  • The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq
  • Other Designations:
  • MGST1-like 1,OTTHUMP00000022345,glutathione S-transferase 1-like 1,microsomal glutathione S-transferase 1-like 1,microsomal prostaglandin E synthase-1,p53-induced apoptosis protein 12,p53-induced gene 12,tumor protein p53 inducible protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook