Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTGES purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009536-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PTGES protein.
  • Immunogen:
  • PTGES (NP_004869.1, 1 a.a. ~ 152 a.a) full-length human protein.
  • Sequence:
  • MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PTGES MaxPab polyclonal antibody. Western Blot analysis of PTGES expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PTGES expression in transfected 293T cell line (H00009536-T01) by PTGES MaxPab polyclonal antibody.

    Lane 1: PTGES transfected lysate(16.72 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9536
  • Gene Name:
  • PTGES
  • Gene Alias:
  • MGC10317,MGST-IV,MGST1-L1,MGST1L1,MPGES,PGES,PIG12,PP102,PP1294,TP53I12,mPGES-1
  • Gene Description:
  • prostaglandin E synthase
  • Gene Summary:
  • The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq
  • Other Designations:
  • MGST1-like 1,OTTHUMP00000022345,glutathione S-transferase 1-like 1,microsomal glutathione S-transferase 1-like 1,microsomal prostaglandin E synthase-1,p53-induced apoptosis protein 12,p53-induced gene 12,tumor protein p53 inducible protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook