BAG2 monoclonal antibody (M01), clone 6E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BAG2 monoclonal antibody (M01), clone 6E12 Western Blot analysis of BAG2 expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BAG2.
Immunogen
BAG2 (NP_004273, 102 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BAG2 monoclonal antibody (M01), clone 6E12 Western Blot analysis of BAG2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — BAG2
Entrez GeneID
9532GeneBank Accession#
NM_004282Protein Accession#
NP_004273Gene Name
BAG2
Gene Alias
BAG-2, KIAA0576, MGC149462, dJ417I1.2
Gene Description
BCL2-associated athanogene 2
Omim ID
603882Gene Ontology
HyperlinkGene Summary
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq
Other Designations
BAG-family molecular chaperone regulator-2|OTTHUMP00000016668|dJ417I1.2 (BAG-family molecular chaperone regulator 2)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com