EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EEF1E1 MaxPab polyclonal antibody. Western Blot analysis of EEF1E1 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of EEF1E1 expression in transfected 293T cell line (H00009521-T02) by EEF1E1 MaxPab polyclonal antibody.
Lane 1: EEF1E1 transfected lysate(19.14 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EEF1E1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EEF1E1 protein.
Immunogen
EEF1E1 (NP_004271.1, 1 a.a. ~ 174 a.a) full-length human protein.
Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EEF1E1 MaxPab polyclonal antibody. Western Blot analysis of EEF1E1 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of EEF1E1 expression in transfected 293T cell line (H00009521-T02) by EEF1E1 MaxPab polyclonal antibody.
Lane 1: EEF1E1 transfected lysate(19.14 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EEF1E1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EEF1E1
Entrez GeneID
9521GeneBank Accession#
NM_004280.2Protein Accession#
NP_004271.1Gene Name
EEF1E1
Gene Alias
AIMP3, P18
Gene Description
eukaryotic translation elongation factor 1 epsilon 1
Omim ID
609206Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
ARS-interacting multifunctional protein 3|OTTHUMP00000016008|p18 component of aminoacyl-tRNA synthetase complex
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com