Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009521-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human EEF1E1 protein.
  • Immunogen:
  • EEF1E1 (NP_004271.1, 1 a.a. ~ 174 a.a) full-length human protein.
  • Sequence:
  • MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EEF1E1 MaxPab polyclonal antibody. Western Blot analysis of EEF1E1 expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EEF1E1 expression in transfected 293T cell line (H00009521-T02) by EEF1E1 MaxPab polyclonal antibody.

    Lane 1: EEF1E1 transfected lysate(19.14 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9521
  • Gene Name:
  • EEF1E1
  • Gene Alias:
  • AIMP3,P18
  • Gene Description:
  • eukaryotic translation elongation factor 1 epsilon 1
  • Gene Summary:
  • This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • ARS-interacting multifunctional protein 3,OTTHUMP00000016008,p18 component of aminoacyl-tRNA synthetase complex
  • RSS
  • YouTube
  • Linkedin
  • Facebook