SPTLC2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SPTLC2.
Immunogen
SPTLC2 (NP_004854, 453 a.a. ~ 561 a.a) partial recombinant protein with GST tag.
Sequence
LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.1 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in Raw 264.7. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605720)Western Blot (Cell lysate)
SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in NIH/3T3. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605722)Western Blot (Recombinant protein)
ELISA
-
Gene Info — SPTLC2
Entrez GeneID
9517GeneBank Accession#
NM_004863Protein Accession#
NP_004854Gene Name
SPTLC2
Gene Alias
KIAA0526, LCB2, SPT2
Gene Description
serine palmitoyltransferase, long chain base subunit 2
Omim ID
605713Gene Ontology
HyperlinkGene Summary
This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
serine palmitoyltransferase, subunit II
-
Interactome
-
Pathway
-
Publication Reference
-
ORMDL orosomucoid-like proteins are degraded by free-cholesterol-loading-induced autophagy.
Wang S, Robinet P, Smith JD, Gulshan K.
PNAS 2015 Mar; 112(12):3728.
Application:IP, IP-WB, WB-Ce, Mouse, RAW264.7 cells.
-
ORMDL orosomucoid-like proteins are degraded by free-cholesterol-loading-induced autophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com