Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPTLC2 polyclonal antibody (A01)

  • Catalog # : H00009517-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SPTLC2.
  • Immunogen:
  • SPTLC2 (NP_004854, 453 a.a. ~ 561 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009517-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in Raw 264.7. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605720)
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in NIH/3T3. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605722)
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9517
  • Gene Name:
  • SPTLC2
  • Gene Alias:
  • KIAA0526,LCB2,SPT2
  • Gene Description:
  • serine palmitoyltransferase, long chain base subunit 2
  • Gene Summary:
  • This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • serine palmitoyltransferase, subunit II
  • RSS
  • YouTube
  • Linkedin
  • Facebook