Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LITAF (Human) Recombinant Protein (P01)

  • Catalog # : H00009516-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LITAF full-length ORF ( NP_004853.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009516-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9516
  • Gene Name:
  • LITAF
  • Gene Alias:
  • FLJ38636,MGC116698,MGC116700,MGC116701,MGC125274,MGC125275,MGC125276,PIG7,SIMPLE,TP53I7
  • Gene Description:
  • lipopolysaccharide-induced TNF factor
  • Gene Summary:
  • Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
  • Other Designations:
  • LPS-induced TNF-alpha factor,lipopolysaccharide-induced TNF-alpha factor,lipopolysaccharide-induced tumor necrosis factor-alpha factor,p53-induced gene 7 protein,small integral membrane protein of lysosome/late endosome,tumor protein p53 inducible protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook