Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAGE4 (Human) Recombinant Protein (P01)

  • Catalog # : H00009506-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAGE4 full-length ORF ( NP_008934.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009506-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9506
  • Gene Name:
  • PAGE4
  • Gene Alias:
  • FLJ35184,GAGE-9,GAGEC1,JM-27,JM27,PAGE-1,PAGE-4
  • Gene Description:
  • P antigen family, member 4 (prostate associated)
  • Gene Summary:
  • This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
  • Other Designations:
  • G antigen, family C, 1,OTTHUMP00000025849,OTTHUMP00000025850,prostate-associated gene protein 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook