PAGE4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PAGE4 full-length ORF ( NP_008934.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PAGE4
Entrez GeneID
9506GeneBank Accession#
NM_007003.2Protein Accession#
NP_008934.1Gene Name
PAGE4
Gene Alias
FLJ35184, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
Gene Description
P antigen family, member 4 (prostate associated)
Omim ID
300287Gene Ontology
HyperlinkGene Summary
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
Other Designations
G antigen, family C, 1|OTTHUMP00000025849|OTTHUMP00000025850|prostate-associated gene protein 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com