Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAGE4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009506-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PAGE4 protein.
  • Immunogen:
  • PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length human protein.
  • Sequence:
  • MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PAGE4 expression in transfected 293T cell line (H00009506-T01) by PAGE4 MaxPab polyclonal antibody.

    Lane 1: PAGE4 transfected lysate(11.22 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9506
  • Gene Name:
  • PAGE4
  • Gene Alias:
  • FLJ35184,GAGE-9,GAGEC1,JM-27,JM27,PAGE-1,PAGE-4
  • Gene Description:
  • P antigen family, member 4 (prostate associated)
  • Gene Summary:
  • This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
  • Other Designations:
  • G antigen, family C, 1,OTTHUMP00000025849,OTTHUMP00000025850,prostate-associated gene protein 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook