XAGE1D monoclonal antibody (M01), clone 4D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAGE1D is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant XAGE1D.
Immunogen
XAGE1D (NP_597673.1, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQVLGREMRDMEGDLQELHQSNTGDKSGFGFRRQGEDNT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAGE1D is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — XAGE1D
Entrez GeneID
9503GeneBank Accession#
NM_133430.1Protein Accession#
NP_597673.1Gene Name
XAGE1D
Gene Alias
-
Gene Description
X antigen family, member 1D
Omim ID
300289Gene Ontology
HyperlinkGene Summary
This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene, in addition to the use of an alternative transcription start site and an alternative translation initiation codon, results in multiple variants that encode different isoforms. [provided by RefSeq
Other Designations
G antigen, family D, 2|OTTHUMP00000042367
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com