Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

XAGE2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009502-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human XAGE2 partial ORF ( NP_570133, 44 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.22
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009502-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9502
  • Gene Name:
  • XAGE2
  • Gene Alias:
  • GAGED3,XAGE-2
  • Gene Description:
  • X antigen family, member 2
  • Gene Summary:
  • This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
  • Other Designations:
  • G antigen, family D, 3,OTTHUMP00000023313,XAGE-2 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook