XAGE2 monoclonal antibody (M12), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of XAGE2 expression in transfected 293T cell line by XAGE2 monoclonal antibody (M12), clone 4C4.
Lane 1: XAGE2 transfected lysate (Predicted MW: 12.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAGE2 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant XAGE2.
Immunogen
XAGE2 (NP_570133, 44 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of XAGE2 expression in transfected 293T cell line by XAGE2 monoclonal antibody (M12), clone 4C4.
Lane 1: XAGE2 transfected lysate (Predicted MW: 12.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAGE2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — XAGE2
Entrez GeneID
9502GeneBank Accession#
NM_130777Protein Accession#
NP_570133Gene Name
XAGE2
Gene Alias
GAGED3, XAGE-2
Gene Description
X antigen family, member 2
Omim ID
300416Gene Ontology
HyperlinkGene Summary
This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
Other Designations
G antigen, family D, 3|OTTHUMP00000023313|XAGE-2 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com