MAGED1 monoclonal antibody (M06), clone 1E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAGED1 monoclonal antibody (M06), clone 1E1. Western Blot analysis of MAGED1 expression in Jurkat ( Cat # L017V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAGED1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGED1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGED1.
Immunogen
MAGED1 (NP_001005333, 117 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNAN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAGED1 monoclonal antibody (M06), clone 1E1. Western Blot analysis of MAGED1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAGED1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGED1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — MAGED1
Entrez GeneID
9500GeneBank Accession#
NM_001005333Protein Accession#
NP_001005333Gene Name
MAGED1
Gene Alias
DLXIN-1, NRAGE
Gene Description
melanoma antigen family D, 1
Omim ID
300224Gene Ontology
HyperlinkGene Summary
This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023302|OTTHUMP00000023303|OTTHUMP00000023304|OTTHUMP00000023305|neurotrophin receptor-interacting MAGE homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com