Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAGED1 polyclonal antibody (A01)

  • Catalog # : H00009500-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAGED1.
  • Immunogen:
  • MAGED1 (NP_001005333, 117 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNAN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009500-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MAGED1 polyclonal antibody (A01), Lot # 060927JCS1 Western Blot analysis of MAGED1 expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9500
  • Gene Name:
  • MAGED1
  • Gene Alias:
  • DLXIN-1,NRAGE
  • Gene Description:
  • melanoma antigen family D, 1
  • Gene Summary:
  • This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023302,OTTHUMP00000023303,OTTHUMP00000023304,OTTHUMP00000023305,neurotrophin receptor-interacting MAGE homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook