Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009495-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKAP5 partial ORF ( NP_004848.2, 334 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009495-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9495
  • Gene Name:
  • AKAP5
  • Gene Alias:
  • AKAP75,AKAP79,H21
  • Gene Description:
  • A kinase (PRKA) anchor protein 5
  • Gene Summary:
  • The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 5,A-kinase anchor protein, 79kDa,A-kinase anchoring protein 75/79,cAMP-dependent protein kinase regulatory subunit II high affinity binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook