AKAP5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AKAP5 partial ORF ( NP_004848.2, 334 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Interspecies Antigen Sequence
Mouse (48); Rat (47)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AKAP5
Entrez GeneID
9495GeneBank Accession#
NM_004857Protein Accession#
NP_004848.2Gene Name
AKAP5
Gene Alias
AKAP75, AKAP79, H21
Gene Description
A kinase (PRKA) anchor protein 5
Omim ID
604688Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq
Other Designations
A-kinase anchor protein 5|A-kinase anchor protein, 79kDa|A-kinase anchoring protein 75/79|cAMP-dependent protein kinase regulatory subunit II high affinity binding protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com