AKAP5 monoclonal antibody (M04), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP5.
Immunogen
AKAP5 (NP_004848.2, 334 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (48); Rat (47)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AKAP5 expression in transfected 293T cell line by AKAP5 monoclonal antibody (M04), clone 1A9.
Lane 1: AKAP5 transfected lysate(47.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — AKAP5
Entrez GeneID
9495GeneBank Accession#
NM_004857Protein Accession#
NP_004848.2Gene Name
AKAP5
Gene Alias
AKAP75, AKAP79, H21
Gene Description
A kinase (PRKA) anchor protein 5
Omim ID
604688Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq
Other Designations
A-kinase anchor protein 5|A-kinase anchor protein, 79kDa|A-kinase anchoring protein 75/79|cAMP-dependent protein kinase regulatory subunit II high affinity binding protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com