Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATG5 monoclonal antibody (M05), clone 1E7

  • Catalog # : H00009474-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ATG5.
  • Immunogen:
  • ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009474-M05
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Raw 264.7(Cat # L024V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in NIH/3T3(Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9474
  • Gene Name:
  • ATG5
  • Gene Alias:
  • APG5,APG5-LIKE,APG5L,ASP,hAPG5
  • Gene Description:
  • ATG5 autophagy related 5 homolog (S. cerevisiae)
  • Other Designations:
  • APG5 (autophagy 5, S. cerevisiae)-like,APG5 autophagy 5-like,ATG5 autophagy related 5-like,OTTHUMP00000017823,OTTHUMP00000017824,OTTHUMP00000040507,apoptosis specific protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook