AKAP6 monoclonal antibody (M01), clone 1E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP6 is approximately 0.03ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP6.
Immunogen
AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (54); Rat (51)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP6 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — AKAP6
Entrez GeneID
9472GeneBank Accession#
NM_004274Protein Accession#
NP_004265.3Gene Name
AKAP6
Gene Alias
ADAP100, ADAP6, AKAP100, KIAA0311, MGC165020, PRKA6, mAKAP
Gene Description
A kinase (PRKA) anchor protein 6
Omim ID
604691Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq
Other Designations
A-kinase anchor protein 100|A-kinase anchor protein 6|protein kinase A anchoring protein 6
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com