Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF4E2 monoclonal antibody (M02), clone 1A11

  • Catalog # : H00009470-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant EIF4E2.
  • Immunogen:
  • EIF4E2 (NP_004837, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EIF4E2 monoclonal antibody (M02), clone 1A11 Western Blot analysis of EIF4E2 expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9470
  • Gene Name:
  • EIF4E2
  • Gene Alias:
  • 4E-LP,4EHP,EIF4EL3,IF4e
  • Gene Description:
  • eukaryotic translation initiation factor 4E family member 2
  • Other Designations:
  • eIF4E-like cap-binding protein,eukaryotic translation initiation factor 4E member 2,eukaryotic translation initiation factor 4E-like 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook